General Information

  • ID:  hor006438
  • Uniprot ID:  P56283
  • Protein name:  CNP-53
  • Gene name:  NPPC
  • Organism:  Ovis aries (Sheep)
  • Family:  Natriuretic peptide family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Ovis (genus), Caprinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005102 signaling receptor binding; GO:0005179 hormone activity
  • GO BP:  GO:0001503 ossification; GO:0003418 growth plate cartilage chondrocyte differentiation; GO:0003419 growth plate cartilage chondrocyte proliferation; GO:0006182 cGMP biosynthetic process; GO:0007168 receptor guanylyl cyclase signaling pathway; GO:0097746 blood vessel diameter maintenance
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  DLRVDTKSRAAWTRLLHEHPNARKYKGGNKKGLSKGCFGLKLDRIGSMSGLGC
  • Length:  53(74-126)
  • Propeptide:  MHLSQLLACALLLSLLSLRPSEAKPGAPPKVPRTPPGEEVAEPQAAGGGQKKGDKTPGGGGANLKDDRSRLLRDLRVDTKSRAAWTRLLHEHPNARKYKGGNKKGLSKGCFGLKLDRIGSMSGLGC
  • Signal peptide:  MHLSQLLACALLLSLLSLRPSEA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  [CNP-22]: Hormone which plays a role in endochondral ossification through regulation of cartilaginous growth plate chondrocytes proliferation and differentiation (By similarity). May also be vasoactive and natriuretic. Acts by specifically binding and sti
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NPR2, NPR3
  • Target Unid:   W5PQ84, W5PRE4
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  37-53
  • Structure ID:  AF-P56283-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006438_AF2.pdbhor006438_ESM.pdb

Physical Information

Mass: 675649 Formula: C252H418N82O71S3
Absent amino acids: Q Common amino acids: GKL
pI: 10.93 Basic residues: 14
Polar residues: 19 Hydrophobic residues: 14
Hydrophobicity: -72.45 Boman Index: -12133
Half-Life / Aliphatic Index: 1.1 hour Aliphatic Index: 70
Instability Index: 1065.85 Extinction Coefficient cystines: 7115
Absorbance 280nm: 136.83

Literature

  • PubMed ID:  10219521
  • Title:  The characterization of ovine genes for atrial, brain, and C-type natriuretic peptides.